Search results for "Product Surveillance"

showing 10 items of 17 documents

Surveillance for adverse events following immunization (AEFI) for 7 years using a computerised vaccination system

2016

Objectives: The surveillance of vaccine safety is an essential requirement in vaccination programmes. Computerized immunization registries such as the Vaccination Information System (SIV) of Valencian Community (Spain) offer the opportunity to estimate the incidence of adverse events according to individual information. The aim of the study was to analyze adverse events following immunization reported through SIV from 2005 to 2011 by age, sex, type of vaccine and dose, and adverse event, and highlight the advantages of this type of reporting. Study design: A retrospective cohort study of subjects vaccinated in the Valencian Community using population health databases was carried out. Method…

AdultMaleVaccine safetyPediatricsmedicine.medical_specialtyAdolescentDatabases FactualImmunization registryPopulation healthYoung Adult03 medical and health sciences0302 clinical medicine030225 pediatricsProduct Surveillance PostmarketingAdverse Drug Reaction Reporting SystemsHumansMedicine030212 general & internal medicineYoung adultChildAdverse effectAgedRetrospective StudiesVaccinesbusiness.industryIncidence (epidemiology)Public Health Environmental and Occupational HealthInfantRetrospective cohort studyGeneral MedicineMiddle AgedPassive surveillanceVaccinationAEFI (adverse event following immunization)ImmunizationSpainChild PreschoolFemaleSafetybusinessImmunization registry
researchProduct

Post-marketing of disease modifying drugs in multiple sclerosis: an exploratory analysis of gender effect in interferon beta treatment.

2009

Background: There are a few and conflicting results from randomised controlled trials (RCTs) pertaining to the influence of gender in response to currently used disease modifying drugs in Multiple Sclerosis (MS). Observational studies may be especially valuable for answering effectiveness questions in subgroups not studied in RCTs. Objective: To conduct a post-marketing analysis aimed to evaluate the gender effect on Interferon beta (IFN beta) treatment response in a cohort of relapsing (RR) MS patients. Methods: A cohort of 2570 IFN beta-treated RRMS was prospectively followed for Lip to 7 years in 15 Italian MS Centers. Cox proportional hazards regression models were used to assess gender…

AdultMalemedicine.medical_specialtyMultiple SclerosisPropensity scoreDiseasegender; interferon beta; multiple sclerosis; observational study; propensity scoreLower riskSeverity of Illness IndexMultiple sclerosis Interferon beta Gender Observational study Propensity scoreCohort StudiesDisability EvaluationYoung AdultSex Factorsgender multiple sclerosis treatment interferonDouble-Blind MethodInternal medicineObservational studymedicinegenderConfidence IntervalsOdds RatioProduct Surveillance PostmarketingHumansImmunologic FactorsMultiple sclerosiProportional Hazards ModelsExpanded Disability Status ScaleProportional hazards modelbusiness.industryMultiple sclerosisDrug Administration RoutesInterferon-betamedicine.diseaseInterferon betaSurgeryNeurologyItalyCohortPropensity score matchingRegression AnalysisSettore MED/26 - NeurologiaObservational studyFemaleNeurology (clinical)business
researchProduct

Natalizumab: a country-based surveillance program

2008

Natalizumab is a humanized monoclonal antibody with a selective adhesion-molecule inhibitor effect, and a demonstrated efficacy in decreasing the frequency of relapses and progression of disability in relapsing-remitting multiple sclerosis (RR MS). After the approval of FDA and EMEA in MS cases unresponsive to immunomodulating therapy or in severe MS patients also not previously treated with interferons, and considering the concern on the possible side effects, an accurate program of surveillance was organized in our country by a combined effort of AIFA, Cineca, Department of Pharmacology of University of Bologna, and a group of neurologists appointed by the National Society of Neurology (S…

AdultMalemedicine.medical_specialtyNeurologyDatabases FactualDrug-Related Side Effects and Adverse ReactionsNational Health ProgramsDrug ResistanceDermatologyDiseaseAntibodies Monoclonal HumanizedNatalizumabInternal medicineOutcome Assessment Health CareMultiple SclerosiPharmacovigilanceProduct Surveillance PostmarketingmedicineAdverse Drug Reaction Reporting SystemsHumansImmunologic FactorsMULTIPLE SCLEROSISNATALIZUMABClinical Trials as Topicbusiness.industryMultiple sclerosisAntibodies MonoclonalMean ageGeneral Medicinemedicine.diseasePsychiatry and Mental healthItalyREGISTRYPHARMACOVIGILANCEPhysical therapyFemaleSettore MED/26 - NeurologiaNeurology (clinical)NeurosurgerybusinessPreviously treatedFollow-Up Studiesmedicine.drug
researchProduct

Three years of experience : the Italian registry and safety data update

2011

At the end of 2006, a pharmacovigilance program on natalizumab was settled by the Italian Pharmaceutical Agency, and on January 2007, multiple sclerosis patients poorly responding to the immunomodulating therapies or with an aggressive clinical form of disease from onset initiated to be registered and to receive the medication. On February 2010, almost 3,000 cases have been treated with natalizumab. The drop-out rate is 10%. Almost 800 cases received cycles of natalizumab for more than 18 months. One case of PML was reported and other adverse events are similar to those described in phase III studies. The majority of cases remained stable, while in 25% of cases, an improvement of disability…

AdultMalemedicine.medical_specialtyPediatricsMultiple SclerosisDermatologyDiseaseAntibodies Monoclonal HumanizedNatalizumabPharmacovigilanceProduct Surveillance PostmarketingmedicineHumansRegistriesAdverse effectbusiness.industryNatalizumabMultiple sclerosisGeneral Medicinemedicine.diseasePsychiatry and Mental healthItalyPHARMACOVIGILANCEREGISTRYsurveillance program; pharmacovigilance; multiple sclerosis; natalizumabPhysical therapyFemaleSettore MED/26 - NeurologiaNeurology (clinical)NeurosurgerybusinessMultiple sclerosis NatalizumabSurveillance program Pharmacovigilancemedicine.drug
researchProduct

The pharmacovigilance program on natalizumab in Italy: 2 years of experience.

2009

At the end of 2006 a country-based surveillance program on natalizumab therapy in multiple sclerosis was settled in Italy by a collaborative effort of the Italian Drug Agency (AIFA) and a group of experts and neurologists appointed by the National Society of Neurology (SIN). After 2 years, 1,818 patients are registered in the database. The majority of cases (88.6%) failed the therapy with beta interferon or glatiramer acetate and had relapses or accumulated disability during immunomodulating treatment, while 11.4% of patients enrolled in the surveillance study were not previously treated with immunomodulating therapies and had a rapidly evolving clinical course. Almost 10% of the patients t…

AdultMalemedicine.medical_specialtyPediatricsNeurologyMultiple SclerosisPatient DropoutsDatabases FactualAlternative medicineDermatologyPharmacologyAntibodies Monoclonal HumanizedNatalizumabPharmacovigilanceProduct Surveillance PostmarketingMedicineHumansGlatiramer acetateMultiple sclerosis NatalizumabSurveillance programPharmacovigilancebusiness.industryMultiple sclerosisNatalizumabAntibodies MonoclonalDrug agencyGeneral Medicinemedicine.diseaseMagnetic Resonance ImagingPsychiatry and Mental healthItalyPHARMACOVIGILANCEREGISTRYSettore MED/26 - NeurologiaFemaleNeurology (clinical)Neurosurgerybusinessmedicine.drugFollow-Up StudiesNeurological sciences : official journal of the Italian Neurological Society and of the Italian Society of Clinical Neurophysiology
researchProduct

The KARTAN study: a postmarketing assessment of Irbesartan in patients with hypertension.

2004

An important purpose of postmarketing surveillance of drugs is to better characterize the safety profile of drug therapy in the clinical setting. Another goal is to confirm the effectiveness of these drugs in patients who are candidates for antihypertensive therapy and who may have been excluded from Phase III studies. Irbesartan is a long-acting angiotensin II-receptor blocker specific for the angiotensin 1-receptor subtype that, in clinical trials in patients with hypertension, reduces blood pressure.The KARTAN (this word was derived from the first and last syllables of Karvea [trademark of Bristol-Myers Squibb Group, Madrid, Spain] and irbesartan) study was designed to confirm and extend…

AdultMalemedicine.medical_specialtyPostmarketing surveillanceTetrazolesBlood PressurePharmacologyIrbesartanHeart RateRisk FactorsInternal medicinemedicineProduct Surveillance PostmarketingHumansPharmacology (medical)Prospective cohort studyAntihypertensive AgentsAgedPharmacologyAged 80 and overbusiness.industryBiphenyl CompoundsIrbesartanMiddle AgedAngiotensin IIClinical trialBlood pressureTolerabilitySpainHypertensionObservational studyFemalebusinessmedicine.drugClinical therapeutics
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

ALDEN, an Algorithm for Assessment of Drug Causality in Stevens–Johnson Syndrome and Toxic Epidermal Necrolysis: Comparison With Case–Control Analysis

2010

Epidermal necrolysis (EN)--either Stevens-Johnson syndrome (SJS) or toxic EN (TEN)--is a severe drug reaction. We constructed and evaluated a specific algorithm, algorithm of drug causality for EN (ALDEN), in order to improve the individual assessment of drug causality in EN. ALDEN causality scores were compared with those from the French pharmacovigilance method in 100 cases and the case-control results of the EuroSCAR study. Scores attributed by ALDEN segregated widely. ALDEN pointed to a "probable" or "very probable" causality in 69/100 cases as compared to 23/100 with the French method (P < 0.001). It scored "very unlikely" causality for 64% of medications vs. none with the French metho…

DrugTime FactorsDrug-Related Side Effects and Adverse Reactionsmedia_common.quotation_subjectRecurrenceEpidermal necrolysisPharmacovigilanceProduct Surveillance PostmarketingHumansMedicinePharmacology (medical)Drug reactionProbabilitymedia_commonPharmacologybusiness.industryReproducibility of ResultsStevens johnsonmedicine.diseaseCausalityToxic epidermal necrolysisEuropePharmaceutical PreparationsCase-Control StudiesStevens-Johnson SyndromeCase control analysisFrancebusinessAlgorithmAlgorithmsClinical Pharmacology &amp; Therapeutics
researchProduct

Review of 8 years of experience with Infanrix hexa (DTPa-HBV-IPV/Hib hexavalent vaccine).

2009

Combination vaccines that include multiple antigens within one formulation are now widely accepted as an effective means of eliciting protection against several diseases at the same time. Owing to improvements in quality and convenient modes of administration, they have become part of routine pediatric practice. Hexavalent vaccines, including diphtheria, tetanus, pertussis, hepatitis B, polio and Haemophilus influenzae type b antigens represent the latest advance in the development of combination vaccines. Over 8 years since its first licensure, this review looks at the immunogenicity, efficacy and safety profile of the only hexavalent pediatric vaccine currently in use--Infanrix hexa (diph…

ImmunologyPostmarketing surveillancemedicine.disease_causeDiphtheria-Tetanus-acellular Pertussis Vaccinescomplex mixturesPneumococcal conjugate vaccineDrug DiscoverymedicineProduct Surveillance PostmarketingHumansVaccines CombinedDiphtheria-Tetanus-acellular Pertussis VaccinesHaemophilus VaccinesPharmacologyClinical Trials as TopicTetanusbusiness.industryDiphtheriaPoliovirusmedicine.diseaseVirologyPoliomyelitisVaccinationPoliovirus Vaccine InactivatedImmunologyMolecular Medicinebusinessmedicine.drugExpert review of vaccines
researchProduct

Effectiveness and safety of glecaprevir/pibrentasvir in chronic hepatitis C patients: Results of the Italian cohort of a post-marketing observational…

2021

Abstract Background and Aims The MARS post-marketing, observational study evaluates glecaprevir/pibrentasvir in a large population of Italian patients who are infected with HCV. Patients and Methods Achievement of SVR12 was the primary endpoint in the overall population and by subpopulations of interest (treatment-naive and treatment-experienced patients, subjects infected with different HCV genotype/sub-genotype, cirrhotic and non-cirrhotic patients, patients with different severity of fibrosis, patients with an APRI score ≥1, subjects with comorbidities, HIV-coinfected patients, elderly patients and people who use drugs). Safety and quality of life (assessed by SF-36 and Work Productivity…

MaleAdultmedicine.medical_specialtyPyrrolidinesQuinoxalineSustained Virologic ResponseSettore MED/12 - GASTROENTEROLOGIAPopulationAntiviral AgentselderlyBenzimidazoleGLE/PIBQuinoxalinesInternal medicineDrug CombinationClinical endpointmedicineProduct Surveillance PostmarketingHumansProspective StudieseducationAdverse effectAgedAntiviral AgentSulfonamideseducation.field_of_studyHepatologybusiness.industrySettore MED/09 - MEDICINA INTERNAGastroenterologyPWUDGlecaprevirMiddle Agedelderly; GLE/PIB; HCV; PWUDHepatitis C ChronicPibrentasvirDiscontinuationDrug CombinationsGLE/PIB; HCV; PWUD; elderlyItalyCohortHCVQuality of LifeBenzimidazolesFemaleObservational studybusiness
researchProduct